PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_69667.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 209aa    MW: 22852.8 Da    PI: 9.8234
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_69667.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.6e-41103180178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +CqvegC++ l+ akeyhrrhkvCe+hskap v+v+g eqrfCqqCsrfh++ efD++krsCrrrLa+hnerrrk++a
  MLOC_69667.1 103 RCQVEGCHMVLAGAKEYHRRHKVCEAHSKAPRVIVHGAEQRFCQQCSRFHAMAEFDDAKRSCRRRLAGHNERRRKSNA 180
                   6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3499165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.67E-38102181IPR004333Transcription factor, SBP-box
PfamPF031102.7E-32104177IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEGDGDARSR AGLAWDLGMQ QWAPAASATY PQHFLPPPPP GVASHHHQQQ QHMQQELTSL  60
KLGKRPCSLA GVQVAQVDGT GAAVVEGKRK EKAGAPATAA MPRCQVEGCH MVLAGAKEYH  120
RRHKVCEAHS KAPRVIVHGA EQRFCQQCSR FHAMAEFDDA KRSCRRRLAG HNERRRKSNA  180
NDAMARGTAH AHGNPCHYSH TSISAKYSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3294177184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9646569e-92EU964656.1 Zea mays clone 280651 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581504.22e-78PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ7XT429e-62SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
SwissprotQ01JD19e-62SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLM0YIK11e-154M0YIK1_HORVD; Uncharacterized protein
STRINGMLOC_69667.11e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-38squamosa promoter binding protein-like 2